TAF5-Like RNA Polymerase II, P300/CBP-Associated Factor (PCAF)-Associated Factor, 65kDa (TAF5L) antibody

Antigen: TAF5-Like RNA Polymerase II, P300/CBP-Associated Factor (PCAF)-Associated Factor, 65kDa (TAF5L)

Synonyms: taf5l, MGC80243, MGC89568, TAF5L, PAF65B, fi28g02, zgc:63765, wu:fi28g02

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Dog (Canine), Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN182609

Additional Information

Alternative name: TAF5L

Gene ID: TAF5L

UniProt: O75529

Immunogen: The immunogen for anti-TAF5L antibody: synthetic peptide directed towards the N terminal of human TAF5L

Sequence: LTDSDSQHSHEVMPLLYPLFVYLHLNLVQNSPKSTVESFY SRFHGMFLQN

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-TAF5L antibody concentration is 1 mg/ml.

Description: Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. TAF5L encodes a protein that is a component of the PCAF histone acetylase complex and structurally similar to one of the histone-like TAFs, TAF5. The PCAF histone acetylase complex, which is composed of more than 20 polypeptides some of which are TAFs, is required for myogenic transcription and differentiation.

Characteristics: Antigen Size: 589 amino acids

Molecular Weight: 66kDa

Application Details

Application Notes: WB Suggested Anti-TAF5L Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-TAF5L Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate

Publications

Product: Ogryzko, Kotani, Zhang et al.: "Histone-like TAFs within the PCAF histone acetylase complex." in: Cell, Vol. 94, Issue 1, pp. 35-44, 1998 (PubMed).