Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger Protein 621 (ZNF621) (Middle Region) antibody

Details for Product No. ABIN182611
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF619
Epitope
Middle Region
(7), (6), (1), (1), (1)
Reactivity
Dog (Canine), Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(11), (1), (1), (1), (1)
Host
Rabbit
(10), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(11), (6), (1)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN182611
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ZNF621
Sequence ECKECGKGLSSNTALTQHQRIHTGEKPYECKECGKAFRRS AAYLQHQRLH
Predicted Reactivity Horse : 100 %, Human : 100 %, Rabbit : 100 %, Bovine : 90 %
Characteristics This is a rabbit polyclonal antibody against ZNF621. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name ZNF621
Background ZNF621 is a candidate transcription factor
Molecular Weight 49 kDa
Gene ID 285268
NCBI Accession NM_198484, NP_940886
UniProt Q6ZSS3
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 439 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 621 (ZNF621) (Middle Region) antibody WB Suggested Anti-ZNF621 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Hosts (10), (1)
Reactivities (11), (1), (1), (1), (1)
Applications (11), (6), (1)
Conjugates (1), (1), (1), (1), (1), (1)
Epitopes (7), (6), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN182611
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top