Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182611

Zinc Finger Protein 621 (ZNF621) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF619
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Dog (Canine), Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182611
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF621 antibody: synthetic peptide directed towards the middle region of human ZNF621
Sequence ECKECGKGLSSNTALTQHQRIHTGEKPYECKECGKAFRRS AAYLQHQRLH
Predicted Reactivity Horse : 100%, Human : 100%, Rabbit : 100%, Bovine : 92%
Characteristics This is a rabbit polyclonal antibody against ZNF621. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name ZNF621
Background ZNF621 is a candidate transcription factor
Molecular Weight 49kDa
Gene ID 285268
NCBI Accession NP_940886, NM_198484
UniProt Q6ZSS3
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF621 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Alternatives for antigen "Zinc Finger Protein 621 (ZNF621)", type "Antibodies"
Hosts (6), (1)
Reactivities (7), (1), (1), (1), (1)
Applications (7), (1)
Epitopes (3), (2), (1), (1), (1), (1)
Beacon