Zinc Finger Protein 621 (ZNF621) antibody

Antigen: Zinc Finger Protein 621 (ZNF621)

Synonyms: FLJ23786, FLJ45246, MGC126668, DKFZp686B11107

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Dog (Canine), Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN182611

Additional Information

Alternative name: ZNF621

Gene ID: ZNF621

UniProt: Q6ZSS3

Immunogen: The immunogen for anti-ZNF621 antibody: synthetic peptide directed towards the middle region of human ZNF621

Sequence: ECKECGKGLSSNTALTQHQRIHTGEKPYECKECGKAFRRS AAYLQHQRLH

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-ZNF621 antibody concentration is 1 mg/ml.

Description: ZNF621 is a candidate transcription factor

Characteristics: Antigen Size: 439 amino acids

Molecular Weight: 49kDa

Application Details

Application Notes: WB Suggested Anti-ZNF621 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF621 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate

Publications

Product: Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).