Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

High-Mobility Group 20A (HMG20A) antibody

Antigen

High-Mobility Group 20A (HMG20A)

Synonyms HMGX1, HMGXB1, FLJ10739, fe47h11, wu:fe47h11, zgc:162335, MGC75938, hmg20a, MGC82871, MGC89476, HMG20A, MGC140640
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN182661
Quantity 0.1 mg  (Variants)
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name HMG20A
Gene ID HMG20A
UniProt Q9NP66
Immunogen The immunogen for anti-HMG20A antibody: synthetic peptide directed towards the middle region of human HMG20A
Sequence RKTQDRQKGKSHRQDAARQATHDHEKETEVKERSVFDIPI FTEEFLNHSK
Cross-Reactivity Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-HMG20A antibody concentration is 1 mg/ml.
Description HMG20A plays a role in neuronal differentiation as chromatin-associated protein. HMG20A acts as inhibitor of HMG20B. HMG20A overcomes the repressive effects of the neuronal silencer REST and induces the activation of neuronal-specific genes. HMG20A involved in the recruitment of the histone methyltransferase MLL and consequent increased methylation of histone H3 lysine 4
Characteristics Antigen Size: 347 amino acids
Molecular Weight 40kDa

Application Details

Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only

Publications

Product Rual, Venkatesan, Hao et al.: "Towards a proteome-scale map of the human protein-protein interaction network." in: Nature, Vol. 437, Issue 7062, pp. 1173-8, 2005 (PubMed).

Alternatives

Alternatives for antigen "High-Mobility Group 20A (HMG20A)", type "Antibodies"
Hosts Rabbit (16), Goat (5), Mouse (4)
Reactivities Human (22), Mouse (Murine) (8), Rat (Rattus) (8), Cow (Bovine) (6), Dog (Canine) (5), Chicken (2), Cat (Feline) (1), Goat (1)
Applications Western Blotting (WB) (19), ELISA (13), Immunohistochemistry (IHC) (8), Immunofluorescence (IF) (4), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Dot Blot (Dot) (1), Immunoprecipitation (IP) (1)
Epitopes C-Term (4), Internal Region (2), N-Term (2)