Zinc Finger Protein 839 (ZNF839) (Middle Region) antibody

Details for Product No. ABIN182703
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms C14orf131, ZNF839
Epitope
Middle Region
(1), (1)
Reactivity
Human
(5)
Host
Rabbit
(4), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(5), (2), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN182703
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human C14ORF131
Sequence KMCQDYLSSSGLCSQETLEINNDKVAESLGITEFLRKKEI HPDNLGPKHL
Predicted Reactivity Human :100 %,  
Characteristics This is a rabbit polyclonal antibody against C14ORF131. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name C14ORF131
Background C14orf131 is a protein predicted based on an ORF found in chromosome 14.
Molecular Weight 46 kDa
Gene ID 55778
NCBI Accession NM_018335, NP_060805
UniProt Q9Y595
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 428 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 839 (ZNF839) (Middle Region) antibody WB Suggested Anti-C14ORF131 Antibody Titration: 0.3-0.5ug/ml
Positive Control: HepG2 cell lysate
Background publications Scanlan, Gordan, Williamson et al.: "Antigens recognized by autologous antibody in patients with renal-cell carcinoma." in: International journal of cancer. Journal international du cancer, Vol. 83, Issue 4, pp. 456-64, 1999 (PubMed).

Hosts (4), (1)
Reactivities (5)
Applications (5), (2), (2), (1)
Epitopes (1), (1)
back to top