Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182703

Zinc Finger Protein 839 (ZNF839) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C14orf131, ZNF839
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182703
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C14ORF131 antibody: synthetic peptide directed towards the middle region of human C14ORF131
Sequence KMCQDYLSSSGLCSQETLEINNDKVAESLGITEFLRKKEI HPDNLGPKHL
Predicted Reactivity Human :100%,  
Characteristics This is a rabbit polyclonal antibody against C14ORF131. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name C14ORF131
Background C14orf131 is a protein predicted based on an ORF found in chromosome 14.
Molecular Weight 46kDa
Gene ID 55778
NCBI Accession NP_060805, NM_018335
UniProt Q9Y595
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C14ORF131 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Scanlan, Gordan, Williamson et al.: "Antigens recognized by autologous antibody in patients with renal-cell carcinoma." in: International journal of cancer. Journal international du cancer, Vol. 83, Issue 4, pp. 456-64, 1999 (PubMed).

Alternatives for antigen "Zinc Finger Protein 839 (ZNF839)", type "Antibodies"
Hosts (3), (1)
Reactivities (4)
Applications (4), (2), (2), (1)
Epitopes (1), (1)
Beacon