Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

GATA Zinc Finger Domain Containing 2B (GATAD2B) antibody

Antigen

GATA Zinc Finger Domain Containing 2B (GATAD2B)

Synonyms P66beta, FLJ37346, KIAA1150, MGC138257, MGC138285, RP11-216N14.6, RGD1308533, GATAD2B
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN182715
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name GATAD2B / Hp66 beta
Gene ID GATAD2B
UniProt Q8WXI9
Immunogen The immunogen for anti-GATAD2B antibody: synthetic peptide directed towards the N terminal of human GATAD2B
Sequence HELPTKQDGSGVKGYEEKLNGNLRPHGDNRTAGRPGKENI NDEPVDMSAR
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-GATAD2B antibody concentration is 1 mg/ml.
Description GATAD2B contains 1GATA-type zinc finger. GATAD2B was identified as potent transcriptional repressors interacting with MBD2 and MBD3. GATAD2B, one of the Mi-2/NuRD complex subunits, mediate MBD2 and histone interaction
Characteristics Antigen Size: 593 amino acids
Molecular Weight 65kDa

Application Details

Application Notes WB Suggested Anti-GATAD2B Antibody Titration: 0.2-1 ug/ml
Positive Control: 293T cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Beausoleil, Jedrychowski, Schwartz et al.: "Large-scale characterization of HeLa cell nuclear phosphoproteins." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 101, Issue 33, pp. 12130-5, 2004 (PubMed).

Alternatives

Alternatives for antigen "GATA Zinc Finger Domain Containing 2B (GATAD2B)", type "Antibodies"
Hosts Rabbit (14), Mouse (2), Goat (1)
Reactivities Human (14), Mouse (Murine) (5), Cow (Bovine) (2), Dog (Canine) (2), Rat (Rattus) (2), Zebrafish (1)
Applications Western Blotting (WB) (15), ELISA (7), Immunoprecipitation (IP) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (1)
Epitopes N-Term (4), C-Term (2), AA 1-50 (1), AA 176-191 (1), AA 445-460 (1), AA 50-100 (1), AA 543-593 (1), N-Term,AA 1-30 (1)