Zinc Finger and BTB Domain Containing 43 (ZBTB43) (Middle Region) antibody

Details for Product No. ABIN182720
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF-X, ZBTB22B, ZNF297B, 1700010E06Rik, Zfp297b, mKIAA0414
Epitope
Middle Region
(4), (2), (1), (1)
Reactivity
Dog (Canine), Mouse (Murine), Rat (Rattus), Cow (Bovine), Human, Chicken
(21), (17), (15), (15), (14), (3)
Host
Rabbit
(22)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(13), (10), (3), (3)
Pubmed 1 reference available
Catalog no. ABIN182720
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ZNF297B
Sequence QLTEHEYLPSNSSTEHDRLSTEMASQDGEEGASDSAEFHY TRPMYSKPSI
Predicted Reactivity Mouse :100 %,   Chicken :100 %,   Western clawed frog :100 %,   Bovine :100 %,   Rat :100 %,   Human :100 %,  
Characteristics This is a rabbit polyclonal antibody against ZNF297B. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF297B
Background ZNF297B is a new candidate transcription factor
Molecular Weight 53 kDa
Gene ID 23099
NCBI Accession NM_014007, NP_054726
UniProt O43298
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 467 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Hosts (22)
Reactivities (21), (17), (15), (15), (14), (3)
Applications (13), (10), (3), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top