Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182720

Zinc Finger and BTB Domain Containing 43 (ZBTB43) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF-X, ZBTB22B, ZNF297B, 1700010E06Rik, Zfp297b, mKIAA0414
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Dog (Canine), Mouse (Murine), Rat (Rattus), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182720
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF297B antibody: synthetic peptide directed towards the middle region of human ZNF297B
Sequence QLTEHEYLPSNSSTEHDRLSTEMASQDGEEGASDSAEFHY TRPMYSKPSI
Predicted Reactivity Mouse :100%,   Chicken :100%,   Western clawed frog :100%,   Bovine :100%,   Rat :100%,   Human :100%,  
Characteristics This is a rabbit polyclonal antibody against ZNF297B. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF297B
Background ZNF297B is a new candidate transcription factor
Molecular Weight 53kDa
Gene ID 23099
NCBI Accession NP_054726, NM_014007
UniProt O43298
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF297B antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Alternatives for antigen "Zinc Finger and BTB Domain Containing 43 (ZBTB43)", type "Antibodies"
Hosts (22)
Reactivities (21), (17), (15), (15), (14), (3)
Applications (13), (10), (4), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (2), (1), (1)
Beacon