Zinc Finger and BTB Domain Containing 43 (ZBTB43) antibody

Antigen: Zinc Finger and BTB Domain Containing 43 (ZBTB43)

Synonyms: ZNF-X, ZBTB22B, ZNF297B

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Dog (Canine), Mouse (Murine), Rat (Rattus), Chicken

Application: Western Blotting (WB)

Catalog no.: ABIN182720

Additional Information

Alternative name: ZBTB43

Gene ID: ZNF297B

UniProt: O43298

Immunogen: The immunogen for anti-ZNF297B antibody: synthetic peptide directed towards the middle region of human ZNF297B

Sequence: QLTEHEYLPSNSSTEHDRLSTEMASQDGEEGASDSAEFHY TRPMYSKPSI

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZNF297B antibody concentration is 1 mg/ml.

Description: ZNF297B is a new candidate transcription factor

Characteristics: Antigen Size: 467 amino acids

Molecular Weight: 53kDa

Application Details

Application Notes: WB Suggested Anti-ZNF297B Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Thymus.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF297B Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Thymus

Publications

Product: Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).