Zinc Finger Protein 654 (ZNF654) antibody

Antigen: Zinc Finger Protein 654 (ZNF654)

Synonyms: FLJ10997, FLJ21142, Zfp654, RGD1308321, ZNF654, C1H3orf38, zfp654

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN182748

Additional Information

Alternative name: ZNF654

Gene ID: ZNF654

UniProt: Q9NV14

Immunogen: The immunogen for anti-ZNF654 antibody: synthetic peptide directed towards the middle region of human ZNF654

Sequence: TKSHRTFQAQCSFPECHELFEDLPLLYEHEAQHYLSKTPE SSAQPSETIL

Cross-Reactivity: Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZNF654 antibody concentration is 1 mg/ml.

Description: The ZNF654 gene, located on chromosome 17, encodes a protein that is part of the zinc finger family.

Characteristics: Antigen Size: 299 amino acids

Molecular Weight: 33kDa

Application Details

Application Notes: WB Suggested Anti-ZNF654 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Lung.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF654 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Lung

anti-Zinc Finger Protein 654 (ZNF654) antibody (Image 2)

Publications

Product: Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).