T-Box 20 (TBX20) (N-Term) antibody

Details for Product No. ABIN182755
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ASD4, Tbx12, AL022859, 9430010M06Rik, hrt, cb826, ZF-TBX20, tbx20-A, XTBX20, TBX20, tbx20
Epitope
N-Term
(9), (7), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Human, Zebrafish (Danio rerio), Chicken
(14), (3), (1), (1), (1), (1), (1), (1)
Host
Rabbit
(13), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(14), (6), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN182755
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human TBX20
Sequence MEFTASPKPQLSSRANAFSIAALMSSGGSKEKEATENTIK PLEQFVEKSS
Predicted Reactivity African clawed frog : 100 %, Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 100 %
Characteristics This is a rabbit polyclonal antibody against TBX20. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name TBX20
Background TBX20 is a member of the T-box transcription factor family expressed in the developing heart, eye, ventral neural tube, and limbs, indicating a possible role in regulating development of these tissues.
Molecular Weight 49 kDa
Gene ID 57057
NCBI Accession NM_020417, NP_065150
UniProt Q9UMR3
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 447 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-T-Box 20 (TBX20) (N-Term) antibody WB Suggested Anti-TBX20 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
anti-T-Box 20 (TBX20) (N-Term) antibody (2) anti-T-Box 20 (TBX20) (N-Term) antibody (Image 2)
anti-T-Box 20 (TBX20) (N-Term) antibody (3) anti-T-Box 20 (TBX20) (N-Term) antibody (Image 3)
Background publications Scherer, Cheung, MacDonald et al.: "Human chromosome 7: DNA sequence and biology." in: Science (New York, N.Y.), Vol. 300, Issue 5620, pp. 767-72, 2003 (PubMed).

Hosts (13), (1)
Reactivities (14), (3), (1), (1), (1), (1), (1), (1)
Applications (14), (6), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1)
Epitopes (9), (7), (2), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top