Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182767

IKAROS Family Zinc Finger 5 (Pegasus) (IKZF5) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms pegasus, znfn1a5, ZNFN1A5, 2610034F18Rik, PEGASUS, Zfpn1a5
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN182767
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNFN1A5 antibody: synthetic peptide directed towards the N terminal of human ZNFN1A5
Sequence MGEKKPEPLDFVKDFQEYLTQQTHHVNMISGSVSGDKEAE ALQGAGTDGD
Predicted Reactivity Bovine :100%,   Human :100%,   Sumatran orangutan :100%,   Chicken :100%,   Rat :100%,   Mouse :100%,   Western clawed frog :92%,   Zebrafish :92%,   African clawed frog :92%,   Green puffer :78%,  
Characteristics This is a rabbit polyclonal antibody against ZNFN1A5. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name ZNFN1A5
Background Members of the Ikaros (ZNFN1A1, MIM 603023) family of transcription factors, which includes Pegasus, are expressed in lymphocytes and are implicated in the control of lymphoid development.
Molecular Weight 47kDa
Gene ID 64376
NCBI Accession NP_071911, NM_022466
UniProt Q8TBE5
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNFN1A5 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Perdomo, Holmes, Chong et al.: "Eos and pegasus, two members of the Ikaros family of proteins with distinct DNA binding activities." in: The Journal of biological chemistry, Vol. 275, Issue 49, pp. 38347-54, 2001 (PubMed).

Alternatives for antigen "IKAROS Family Zinc Finger 5 (Pegasus) (IKZF5)", type "Antibodies"
Hosts (4), (2)
Reactivities (5), (1), (1), (1), (1), (1), (1), (1)
Applications (5), (2), (1), (1), (1), (1)
Epitopes (2), (1), (1)
Beacon