Snail Homolog 1 (Drosophila) (SNAI1) antibody

Antigen: Snail Homolog 1 (Drosophila) (SNAI1)

Synonyms: SNA, SNAH, SLUGH2, dJ710H13.1, Sna, Sna1, Snail, Snail1, AI194338, SNAI1, BG:DS01845.1, br28, CG3956, DmelCG3956, l(2)35Db, l(2)br28, l(3)br28, l35Db, sn, snai1, sna, MGC64552, Snai

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN182776

Additional Information

Alternative name: SNAI1

Gene ID: SNAI1

UniProt: O95863

Immunogen: The immunogen for anti-SNAI1 antibody: synthetic peptide directed towards the N terminal of human SNAI1

Sequence: MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHL LAAIPPPEIL

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-SNAI1 antibody concentration is 1 mg/ml.

Description: The Drosophila embryonic protein snail is a zinc finger transcriptional repressor which downregulates the expression of ectodermal genes within the mesoderm. The nuclear protein encoded by this gene is structurally similar to the Drosophila snail protein, and is also thought to be critical for mesoderm formation in the developing embryo.

Characteristics: Antigen Size: 264 amino acids

Molecular Weight: 29kDa

Application Details

Application Notes: WB Suggested Anti-SNAI1 Antibody Titration: 1ug/ml
Positive Control: 721_B cell lysate.
IHC Suggested Anti-SNAI1 Antibody Titration: 4-8ug/ml
Tissue: Human Kidney, epithelial cells of renal tube (indicated with arrows)
Magnification: 400X

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-SNAI1 Antibody Titration: 1ug/ml
Positive Control: 721_B cell lysate

IHC Suggested Anti-SNAI1 Antibody Titration: 4-8ug/ml
Tissue: Human Kidney, epithelial cells of renal tube (indicated with arrows)
Magnification:400X

Publications

Product: Zhou, Deng, Xia et al.: "Dual regulation of Snail by GSK-3beta-mediated phosphorylation in control of epithelial-mesenchymal transition." in: Nature cell biology, Vol. 6, Issue 10, pp. 931-40, 2004 (PubMed).