Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

SRY (Sex Determining Region Y)-Box 11 (SOX11) antibody

Antigen

SRY (Sex Determining Region Y)-Box 11 (SOX11)
Synonyms XLS13, XLS13b, xsox11, xSOX-11, MGC79621, SOX11
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Chicken, Human, Mouse (Murine), Rat (Rattus)
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
2 references available
Catalog no. ABIN182780
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-SRY (Sex Determining Region Y)-Box 11 (SOX11) antibody

Additional Information
Application Details Publications Images Alternatives Variants back to top

Alternative name SOX11
Gene ID SOX11
UniProt P35716
Immunogen The immunogen for anti-SOX11 antibody: synthetic peptide directed towards the N terminal of human SOX11
Sequence MVQQAESLEAESNLPREALDTEEGEFMACSPVALDESDPD WCKTASGHIK
Cross-Reactivity Chicken, Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-SOX11 antibody concentration is 1 mg/ml.
Description This intronless gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The protein may function in the developing nervous system and play a role in tumorigenesis.
Characteristics Antigen Size: 441 amino acids
Molecular Weight 47kDa

Application Details
Publications Images Alternatives Variants back to top

Application Notes WB Suggested Anti-SOX11 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Neurology, Transcription Factors
Restrictions For Research Use only

Publications
Application Details Images Alternatives Variants back to top

Branas, Elliott, Richmond et al.: "Alcohol consumption, alcohol outlets, and the risk of being assaulted with a gun." in: Alcoholism, clinical and experimental research, Vol. 33, Issue 5, pp. 906-15, 2009 (PubMed).

Product Wiebe, Nowling, Rizzino: "Identification of novel domains within Sox-2 and Sox-11 involved in autoinhibition of DNA binding and partnership specificity." in: The Journal of biological chemistry, Vol. 278, Issue 20, pp. 17901-11, 2003 (PubMed).

Alternatives
Application Details Publications Images Variants back to top

Alternatives for antigen "SRY (Sex Determining Region Y)-Box 11 (SOX11)", type "Antibodies"
Hosts Rabbit (30), Goat (4), Sheep (1)
Reactivities Human (34), Mouse (Murine) (24), Rat (Rattus) (24), Cow (Bovine) (19), Pig (Porcine) (19), Chicken (2), Xenopus laevis (1)
Applications Western Blotting (WB) (18), Immunofluorescence (IF) (15), ELISA (12), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (5), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunoprecipitation (IP) (2), Immunocytochemistry (ICC) (1), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (Fixed) (IHC (fx)) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes Internal Region (4), AA 309-323 (2), N-Term (2), AA 112-125 (1), Internal Region,AA 309-323 (1), N-Term,AA 102-132 (1)