MRG-Binding Protein (MRGBP) antibody

Antigen: MRG-Binding Protein (MRGBP)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine)

Application: Western Blotting (WB)

Catalog no.: ABIN182783

Additional Information

Alternative name: MRGBP

Gene ID: C20ORF20

UniProt: Q9NV56

Immunogen: The immunogen for anti-C20ORF20 antibody: synthetic peptide directed towards the N terminal of human C20ORF20

Sequence: MGEAEVGGGGAAGDKGPGEAATSPAEETVVWSPEVEVCLF HAMLGHKPVG

Cross-Reactivity: Cow (Bovine), Human, Mouse (Murine)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-C20ORF20 antibody concentration is 1 mg/ml.

Description: C20orf20 is a component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair.

Characteristics: Antigen Size: 204 amino acids

Molecular Weight: 22kDa

Application Details

Application Notes: WB Suggested Anti-C20ORF20 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-C20ORF20 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T

Publications

Product: Cai, Jin, Tomomori-Sato et al.: "Identification of new subunits of the multiprotein mammalian TRRAP/TIP60-containing histone acetyltransferase complex." in: The Journal of biological chemistry, Vol. 278, Issue 44, pp. 42733-6, 2003 (PubMed).