ZFP36 Ring Finger Protein-Like 1 (ZFP36L1) antibody

Antigen: ZFP36 Ring Finger Protein-Like 1 (ZFP36L1)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN182793

Additional Information

Alternative name: TIS11B / ZFP36L1

Gene ID: ZFP36L1

UniProt: Q07352

Immunogen: The immunogen for anti-ZFP36L1 antibody: synthetic peptide directed towards the N terminal of human ZFP36L1

Sequence: GGGFPRRHSVTLPSSKFHQNQLLSSLKGEPAPALSSRDSR FRDRSFSEGG

Cross-Reactivity: Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-ZFP36L1 antibody concentration is 1 mg/ml.

Description: ZFP36L1 is a member of the TIS11 family of early response genes. Family members are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. The gene is well conserved across species and has a promoter that contains motifs seen in other early-response genes. The encoded protein contains a distinguishing putative zinc finger domain with a repeating cys-his motif. This putative nuclear transcription factor most likely functions in regulating the response to growth factors.This gene is a member of the TIS11 family of early response genes. Family members are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. The gene is well conserved across species and has a promoter that contains motifs seen in other early-response genes. The encoded protein contains a distinguishing putative zinc finger domain with a repeating cys-his motif. This putative nuclear transcription factor most likely functions in regulating the response to growth factors.

Characteristics: Antigen Size: 338 amino acids

Molecular Weight: 36kDa

Application Details

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

anti-ZFP36 Ring Finger Protein-Like 1 (ZFP36L1) antibody

Publications

Product: Rual, Venkatesan, Hao et al.: "Towards a proteome-scale map of the human protein-protein interaction network." in: Nature, Vol. 437, Issue 7062, pp. 1173-8, 2005 (PubMed).