Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

T-Box 6 (TBX6) antibody

Antigen

T-Box 6 (TBX6)

Synonyms DFNB67, rv, Tbx6L, CH-TBX6L, TBX6, MGC79458, tbx6
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN182800
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name TBX6
Gene ID TBX6
UniProt O95947
Immunogen The immunogen for anti-TBX6 antibody: synthetic peptide directed towards the middle region of human TBX6
Sequence AKGFRENGRNCKRERDARVKRKLRGPEPAATEAYGSGDTP GGPCDSTLGG
Cross-Reactivity Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-TBX6 antibody concentration is 1 mg/ml.
Description TBX6 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is the human ortholog of mouse Tbx6. Knockout experiments in mice indicate that Tbx6 is important for specification of paraxial mesoderm structures.
Characteristics Antigen Size: 436 amino acids
Molecular Weight 47kDa

Application Details

Application Notes WB Suggested Anti-TBX6 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Papapetrou, Putt, Fox et al.: "The human TBX6 gene: cloning and assignment to chromosome 16p11.2." in: Genomics, Vol. 55, Issue 2, pp. 238-41, 1999 (PubMed).

Alternatives

Alternatives for antigen "T-Box 6 (TBX6)", type "Antibodies"
Hosts Rabbit (20), Mouse (2), Goat (1)
Reactivities Human (22), Mouse (Murine) (7), Rat (Rattus) (6), Cow (Bovine) (2), Dog (Canine) (1)
Applications Western Blotting (WB) (19), ELISA (15), Immunohistochemistry (IHC) (4), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (2), Flow Cytometry (FACS) (1), Immunofluorescence (IF) (1)
Epitopes Internal Region (2), N-Term (2), AA 361-377 (1), C-Term (1), Center (1), Center, Trp158 (1)