Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Transcription Factor Dp-2 (E2F Dimerization Partner 2) (TFDP2) antibody

Antigen

Transcription Factor Dp-2 (E2F Dimerization Partner 2) (TFDP2)
Synonyms DP2, Dp-2, DP3, DP-3, 1110029I05Rik, A330080J22Rik, Tcfdp2, TFDP2, dp2, dp-2
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Cow (Bovine), Human, Rat (Rattus), Mouse (Murine), Dog (Canine)
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
1 reference available
Catalog no. ABIN182814
Quantity 0.1 mg
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Transcription Factor Dp-2 (E2F Dimerization Partner 2) (TFDP2) antibody

anti-Transcription Factor Dp-2 (E2F Dimerization Partner 2) (TFDP2) antibody (2)

Additional Information
Application Details Publications Images Alternatives back to top

Alternative name TFDP2
Gene ID TFDP2
UniProt Q14188-4
Immunogen The immunogen for anti-TFDP2 antibody: synthetic peptide directed towards the N terminal of human TFDP2
Sequence MIISTPQRLTSSGSVLIGSPYTPAPAMVTQTHIAEATGWV PGDRKRARKF
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-TFDP2 antibody concentration is 1 mg/ml.
Description The TFDP genes encode a family of transcription factors that can form heterodimers with E2F family proteins in vivo. The E2F-TFDP transcription factors are major regulators of genes that are required for the progression of S-phase, such as DHFR and DNA polymerase alpha, and they play a critical role in cell cycle regulation and differentiation.
Characteristics Antigen Size: 386 amino acids
Molecular Weight 43kDa

Application Details
Publications Images Alternatives back to top

Application Notes WB Suggested Anti-TFDP2 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications
Application Details Images Alternatives back to top

Product Korz, Pscherer, Benner et al.: "Evidence for distinct pathomechanisms in B-cell chronic lymphocytic leukemia and mantle cell lymphoma by quantitative expression analysis of cell cycle and apoptosis-associated genes." in: Blood, Vol. 99, Issue 12, pp. 4554-61, 2002 (PubMed).

Alternatives
Application Details Publications Images back to top

Alternatives for antigen "Transcription Factor Dp-2 (E2F Dimerization Partner 2) (TFDP2)", type "Antibodies"
Hosts Rabbit (26), Mouse (4)
Reactivities Human (27), Mouse (Murine) (22), Rat (Rattus) (20)
Applications Immunofluorescence (IF) (14), Western Blotting (WB) (11), ELISA (6), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Immunohistochemistry (IHC) (2), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (2), Dot Blot (Dot) (1), Gel Shift (GS) (1), Immunoelectron Microscopy (IEM) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes C-Term (2), N-Term (1)