Zinc Finger Protein 24 (ZNF24) antibody

Antigen: Zinc Finger Protein 24 (ZNF24)

Synonyms: KOX17, RSG-A, ZNF191, ZSCAN3, Zfp191

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Rat (Rattus), Mouse (Murine)

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN182823

Additional Information

Alternative name: ZNF24

Gene ID: ZNF24

UniProt: P17028

Immunogen: The immunogen for anti-ZNF24 antibody: synthetic peptide directed towards the middle region of human ZNF24

Sequence: CDDDGRTENGALAPKQELPSALESHEVPGTLSMGVPQIFK YGETCFPKGR

Cross-Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZNF24 antibody concentration is 1 mg/ml.

Description: ZNF24 is a new candidate transcription factor.

Characteristics: Antigen Size: 368 amino acids

Molecular Weight: 42kDa

Application Details

Application Notes: WB Suggested Anti-ZNF24 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF24 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate

anti-Zinc Finger Protein 24 (ZNF24) antibody (Image 2)

Publications

Product: Han, Zhang, Ye et al.: "Molecular cloning of six novel Krüppel-like zinc finger genes from hematopoietic cells and identification of a novel transregulatory domain KRNB." in: The Journal of biological chemistry, Vol. 274, Issue 50, pp. 35741-8, 2000 (PubMed).