Ribosomal Protein S16 (RPS16) antibody

Antigen: Ribosomal Protein S16 (RPS16)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish, Xenopus laevis

Conjugate: Un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN182826

Additional Information

Alternative name: RPS16

Gene ID: RPS16

UniProt: P17008

Immunogen: The immunogen for anti-RPS16 antibody: synthetic peptide directed towards the N terminal of human RPS16

Sequence: SKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMI EPRTLQYKLL

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-RPS16 antibody concentration is 1 mg/ml.

Description: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPS16 is a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S9P family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

Characteristics: Antigen Size: 146 amino acids

Molecular Weight: 16kDa

Application Details

Application Notes: WB Suggested Anti-RPS16 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, DNA/RNA

Restrictions: For Research Use only

Images

WB Suggested Anti-RPS16 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate

anti-Ribosomal Protein S16 (RPS16) antibody (Image 2)

Publications

Product: Yoshihama, Uechi, Asakawa et al.: "The human ribosomal protein genes: sequencing and comparative analysis of 73 genes." in: Genome research, Vol. 12, Issue 3, pp. 379-90, 2002 (PubMed).