Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Zinc Finger Protein 426 (ZNF426) antibody

Antigen

Zinc Finger Protein 426 (ZNF426)
Synonyms MGC2663, Znf426, RGD1564241, ZNF426, ZNF266, MGC156802
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Human, Mouse (Murine), Rat (Rattus)
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN182834
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Zinc Finger Protein 426 (ZNF426) antibody

Additional Information
Application Details Publications Images Alternatives Variants back to top

Alternative name ZNF426
Gene ID ZNF426
UniProt Q9BUY5
Immunogen The immunogen for anti-ZNF426 antibody: synthetic peptide directed towards the N terminal of human ZNF426
Sequence VMLENYKNLATVGGQIIKPSLISWLEQEESRTVQGGVLQG WEMRLETQWS
Cross-Reactivity Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-ZNF426 antibody concentration is 1 mg/ml.
Description Located on chromosome 19, this gene encodes for zinc finger protein 426.
Characteristics Antigen Size: 554 amino acids
Molecular Weight 63kDa

Application Details
Publications Images Alternatives Variants back to top

Application Notes WB Suggested Anti-ZNF426 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Liver.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications
Application Details Images Alternatives Variants back to top

Product Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives
Application Details Publications Images Variants back to top

Alternatives for antigen "Zinc Finger Protein 426 (ZNF426)", type "Antibodies"
Hosts Rabbit (28)
Reactivities Human (28), Mouse (Murine) (5), Rat (Rattus) (5), Cat (Feline) (1), Chicken (1), Cow (Bovine) (1), Dog (Canine) (1)
Applications Immunofluorescence (IF) (16), Western Blotting (WB) (13), ELISA (8), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunohistochemistry (IHC) (2), Immunoelectron Microscopy (IEM) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes N-Term (2)