Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Zinc Finger Protein 212 (ZNF212) antibody

Antigen

Zinc Finger Protein 212 (ZNF212)

Synonyms ZNF182, MGC9707, ZNFC150, C2H2-150, Znf212, mKIAA3011
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Human, Mouse (Murine), Rat (Rattus)

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN182844
Quantity 0.1 mg  (Variants)
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name ZNF212
Gene ID ZNF212
UniProt Q9UDV6
Immunogen The immunogen for anti-ZNF212 antibody: synthetic peptide directed towards the C terminal of human ZNF212
Sequence EGPSAGQHVQERFSPNSLVALPGHIPWRKSRSSLICGYCG KSFSHPSDLV
Cross-Reactivity Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-ZNF212 antibody concentration is 1 mg/ml.
Description ZNF212 belongs to the C2H2-type zinc finger gene family. The zinc finger proteins are involved in gene regulation and development, and are quite conserved throughout evolution. Like this gene product, a third of the zinc finger proteins containing C2H2 fingers also contain the KRAB domain, which has been found to be involved in protein-protein interactions.
Characteristics Antigen Size: 495 amino acids
Molecular Weight 55kDa

Application Details

Application Notes WB Suggested Anti-ZNF212 Antibody Titration: 1.25ug/ml
Positive Control: K562 cell lysate.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only

Publications

Product Scherer, Cheung, MacDonald et al.: "Human chromosome 7: DNA sequence and biology." in: Science (New York, N.Y.), Vol. 300, Issue 5620, pp. 767-72, 2003 (PubMed).

Alternatives

Alternatives for antigen "Zinc Finger Protein 212 (ZNF212)", type "Antibodies"
Hosts Rabbit (4)
Reactivities Human (4), Mouse (Murine) (2), Rat (Rattus) (2)
Applications Western Blotting (WB) (4)
Epitopes C-Term (1), N-Term (1)