Zinc Finger Protein 212 (ZNF212) antibody

Antigen: Zinc Finger Protein 212 (ZNF212)

Synonyms: ZNF182, MGC9707, ZNFC150, C2H2-150, Znf212, mKIAA3011

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN182845

Additional Information

Alternative name: ZNF212

Gene ID: ZNF212

UniProt: Q9UDV6

Immunogen: The immunogen for anti-ZNF212 antibody: synthetic peptide directed towards the N terminal of human ZNF212

Sequence: RSLENDGVCFTEQEWENLEDWQKELYRNVMESNYETLVSL KVLGQTEGEA

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZNF212 antibody concentration is 1 mg/ml.

Description: ZNF212 belongs to the C2H2-type zinc finger gene family. The zinc finger proteins are involved in gene regulation and development, and are quite conserved throughout evolution. Like this gene product, a third of the zinc finger proteins containing C2H2 fingers also contain the KRAB domain, which has been found to be involved in protein-protein interactions.

Characteristics: Antigen Size: 495 amino acids

Molecular Weight: 55kDa

Application Details

Application Notes: WB Suggested Anti-ZNF212 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF212 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate

Publications

Product: Scherer, Cheung, MacDonald et al.: "Human chromosome 7: DNA sequence and biology." in: Science (New York, N.Y.), Vol. 300, Issue 5620, pp. 767-72, 2003 (PubMed).