Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger Protein 606 (ZNF606) (N-Term) antibody

Details for Product No. ABIN182846
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF328, Znf606, ZNF606
Epitope
N-Term
(7), (7), (1), (1), (1)
Reactivity
Mouse (Murine), Dog (Canine), Cow (Bovine), Human
(13)
Host
Rabbit
(12), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(13), (8), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN182846
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF606
Sequence WHVEGSLEEGRRATGLPAAQVQEPVTFKDVAVDFTQEEWG QLDLVQRTLY
Predicted Reactivity Human : 100 %, Dog : 90 %, Bovine : 80 %
Characteristics This is a rabbit polyclonal antibody against ZNF606. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF606
Background ZNF606 is a new candidate transcription factor.
Molecular Weight 92 kDa
Gene ID 80095
NCBI Accession NM_025027, NP_079303
UniProt Q8WXB4
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 792 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN182846
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top