Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182848

Claudin 10 (CLDN10) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms OSP-L, CPETRL3, 6720456I16Rik, Cldn10a, Cldn10b, D14Ertd728e, si:busm1-52i16.3, si:dz52i16.3, CLDN10, DKFZp469F1626
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182848
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CLDN10 antibody: synthetic peptide directed towards the C terminal of human CLDN10
Sequence MASTASEIIAFMVSISGWVLVSSTLPTDYWKVSTIDGTVI TTATYWANLW
Predicted Reactivity Human : 100%, Guinea pig : 93%, Horse : 93%, Mouse : 86%, Rabbit : 86%, Rat : 86%
Characteristics This is a rabbit polyclonal antibody against CLDN10. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name CLDN10
Background CLDN10 encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets.
Molecular Weight 24kDa
Gene ID 9071
NCBI Accession NP_008915, NM_006984
UniProt P78369
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CLDN10 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Gonzualez-Mariscal, Betanzos, Nava et al.: "Tight junction proteins." in: Progress in biophysics and molecular biology, Vol. 81, Issue 1, pp. Jan 44, 2002 (PubMed).

Alternatives for antigen "Claudin 10 (CLDN10)", type "Antibodies"
Hosts (24), (1)
Reactivities (23), (13), (5)
Applications (13), (12), (5), (2), (1), (1), (1)
Epitopes (9), (1), (1)
Beacon