Claudin 15 (CLDN15) (C-Term) antibody

Details for Product No. ABIN182857
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BB107105, 2210009B08Rik, CLDN15, cldn15, cldn15l, zgc:63943, zgc:136755
Epitope
C-Term
(3), (2), (2), (2), (1)
Reactivity
Cow (Bovine), Human
(8), (3), (1), (1), (1)
Host
Rabbit
(11), (2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(13), (2), (2), (2), (2), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN182857
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human CLDN15
Sequence LCSACCCGSDEDPAASARRPYQAPVSVMPVATSDQEGDSS FGKYGRNAYV
Predicted Reactivity Human :100 %,   Bovine :70 %,  
Characteristics This is a rabbit polyclonal antibody against CLDN15. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name CLDN15
Background Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet.
Molecular Weight 24 kDa
Gene ID 24146
NCBI Accession NM_014343, NP_055158
UniProt P56746
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 228 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Claudin 15 (CLDN15) (C-Term) antibody WB Suggested Anti-CLDN15 Antibody Titration: 5.0ug/ml
Positive Control: Jurkat cell lysate
General Gonzualez-Mariscal, Betanzos, Nava et al.: "Tight junction proteins." in: Progress in biophysics and molecular biology, Vol. 81, Issue 1, pp. Jan 44, 2002 (PubMed).

Hosts (11), (2)
Reactivities (8), (3), (1), (1), (1)
Applications (13), (2), (2), (2), (2), (2), (1), (1)
Epitopes (3), (2), (2), (2), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top