Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182857

Claudin 15 (CLDN15) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BB107105, 2210009B08Rik, CLDN15, cldn15, cldn15l, zgc:63943, zgc:136755
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182857
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CLDN15 antibody: synthetic peptide directed towards the C terminal of human CLDN15
Sequence LCSACCCGSDEDPAASARRPYQAPVSVMPVATSDQEGDSS FGKYGRNAYV
Predicted Reactivity Human :100%,   Bovine :76%,  
Characteristics This is a rabbit polyclonal antibody against CLDN15. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name CLDN15
Background Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet.
Molecular Weight 24kDa
Gene ID 24146
NCBI Accession NP_055158, NM_014343
UniProt P56746
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CLDN15 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Gonzualez-Mariscal, Betanzos, Nava et al.: "Tight junction proteins." in: Progress in biophysics and molecular biology, Vol. 81, Issue 1, pp. Jan 44, 2002 (PubMed).

Alternatives for antigen "Claudin 15 (CLDN15)", type "Antibodies"
Hosts (13), (2)
Reactivities (10), (3), (1), (1), (1)
Applications (15), (4), (2), (2), (2), (2), (1), (1)
Epitopes (4), (2), (2), (2), (2), (2), (1)
Beacon