Claudin 15 (CLDN15) antibody

Antigen: Claudin 15 (CLDN15)

Synonyms: FLJ42715, MGC19536, BB107105, 2210009B08Rik, CLDN15, MGC137177, cldn15, MGC63943, zgc:63943, MGC136755, zgc:136755

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human

Application: Western Blotting (WB)

Catalog no.: ABIN182857

Additional Information

Alternative name: Claudin-15 / CLDN15

Gene ID: CLDN15

UniProt: P56746

Immunogen: The immunogen for anti-CLDN15 antibody: synthetic peptide directed towards the C terminal of human CLDN15

Sequence: LCSACCCGSDEDPAASARRPYQAPVSVMPVATSDQEGDSS FGKYGRNAYV

Cross-Reactivity: Cow (Bovine), Human

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-CLDN15 antibody concentration is 1 mg/ml.

Description: Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet.

Characteristics: Antigen Size: 228 amino acids

Molecular Weight: 24kDa

Application Details

Application Notes: WB Suggested Anti-CLDN15 Antibody Titration: 5.0ug/ml
Positive Control: Jurkat cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-CLDN15 Antibody Titration: 5.0ug/ml
Positive Control: Jurkat cell lysate

Publications

Gonzualez-Mariscal, Betanzos, Nava et al.: "Tight junction proteins." in: Progress in biophysics and molecular biology, Vol. 81, Issue 1, pp. Jan 44, 2002 (PubMed).