Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Carboxypeptidase A1 (Pancreatic) (CPA1) antibody

Antigen

Carboxypeptidase A1 (Pancreatic) (CPA1)

Synonyms CPA, Cpa, 0910001L12Rik, CPA1, PCPA1, cpa1, cbpa1
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Rat (Rattus), Mouse (Murine), Pig (Porcine), Dog (Canine)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN182896
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name Carboxypeptidase A1
Gene ID CPA1
UniProt P15085
Immunogen The immunogen for anti-CPA1 antibody: synthetic peptide directed towards the N terminal of human CPA1
Sequence QVLRISVADEAQVQKVKELEDLEHLQLDFWRGPAHPGSPI DVRVPFPSIQ
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-CPA1 antibody concentration is 1 mg/ml.
Description Three different forms of human pancreatic procarboxypeptidase A have been isolated. The A1 and A2 forms are monomeric proteins with different biochemical properties. Carboxypeptidase A1 is a monomeric pancreatic exopeptidase. It is involved in zymogen inhibition.
Characteristics Antigen Size: 419 amino acids
Molecular Weight 47kDa

Application Details

Application Notes WB Suggested Anti-CPA1 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Enzymes, Metabolism
Restrictions For Research Use only

Publications

Product Scherer, Cheung, MacDonald et al.: "Human chromosome 7: DNA sequence and biology." in: Science (New York, N.Y.), Vol. 300, Issue 5620, pp. 767-72, 2003 (PubMed).

Alternatives

Alternatives for antigen "Carboxypeptidase A1 (Pancreatic) (CPA1)", type "Antibodies"
Hosts Rabbit (32), Mouse (5), Goat (1)
Reactivities Human (22), Cow (Bovine) (17), Mouse (Murine) (6), Rat (Rattus) (4), Cat (Feline) (1), Chicken (1), Dog (Canine) (1)
Applications Western Blotting (WB) (37), ELISA (30), Immunohistochemistry (IHC) (14), Immunofluorescence (IF) (9), Immunoprecipitation (IP) (9), Immunocytochemistry (ICC) (4), Dot Blot (Dot) (3), Immunodiffusion (ID) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Radioimmunoassay (RIA) (3), Dot Blot (DB) (1), Flow Cytometry (FACS) (1), Neutralization (Neut) (1)
Conjugates Biotin (3), HRP (3), APC (1)
Epitopes N-Term (4), Internal Region (3), AA 17-419 (2), AA 1-419 (1)