Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Kinesin Family Member 5A (KIF5A) antibody

Antigen

Kinesin Family Member 5A (KIF5A)

Synonyms NKHC, MY050, SPG10, D12S1889, Khc, Kns, Kif5, KIAA4086, mKIAA4086, D10Bwg0738e, KIF5A, fj61a10, wu:fj61a10, si:ch211-166e11.4, nkhc, my050, spg10, d12s1889, MGC122802
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Application
Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
1 reference available
Catalog no. ABIN182897
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name KIF5A
Gene ID KIF5A
UniProt Q12840
Immunogen The immunogen for anti-KIF5A antibody: synthetic peptide directed towards the middle region of human KIF5A
Sequence LEESYDSLSDELAKLQAQETVHEVALKDKEPDTQDADEVK KALELQMESH
Cross-Reactivity Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-KIF5A antibody concentration is 1 mg/ml.
Description KIF5A is a member of the kinesin family of proteins. Members of this family are part of a multisubunit complex that functions as a microtubule motor in intracellular organelle transport. Mutations in this gene cause autosomal dominant spastic paraplegia 10.
Characteristics Antigen Size: 1032 amino acids
Molecular Weight 117kDa

Application Details

Application Notes WB Suggested Anti-KIF5A Antibody Titration: 0.2-1 ug/ml
Positive Control: Human brain.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Cytoskeleton
Restrictions For Research Use only

Publications

Product Reid, Kloos, Ashley-Koch et al.: "A kinesin heavy chain (KIF5A) mutation in hereditary spastic paraplegia (SPG10)." in: American journal of human genetics, Vol. 71, Issue 5, pp. 1189-94, 2002 (PubMed).

Alternatives

Alternatives for antigen "Kinesin Family Member 5A (KIF5A)", type "Antibodies"
Hosts Rabbit (17), Goat (3)
Reactivities Human (15), Mouse (Murine) (8), Rat (Rattus) (7), Cow (Bovine) (2), Cat (Feline) (1), Chicken (1), Dog (Canine) (1)
Applications Western Blotting (WB) (17), ELISA (15), Immunocytochemistry (ICC) (6), Immunofluorescence (IF) (4), Immunohistochemistry (IHC) (4), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (2), Immunoprecipitation (IP) (1)
Epitopes C-Term (5), Internal Region (3), AA 1007-1027 (1), Center (1), Middle Region (1)