Kinesin Family Member 3B (KIF3B) antibody

Antigen: Kinesin Family Member 3B (KIF3B)

Synonyms: HH0048, KIAA0359

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human, Mouse (Murine), Rat (Rattus), Chicken

Application: Western Blotting (WB)

Catalog no.: ABIN182904

Additional Information

Alternative name: KIF3B

Gene ID: KIF3B

UniProt: O15066

Immunogen: The immunogen for anti-KIF3B antibody: synthetic peptide directed towards the C terminal of human KIF3B

Sequence: APKVQAALDAALQDEDEIQVDASSFESTANKKSKARPKSG RKSGSSSSSS

Cross-Reactivity: Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-KIF3B antibody concentration is 1 mg/ml.

Description: The protein encoded by the KIF3B gene acts as a heterodimer with kinesin family member 3A to aid in chromosome movement during mitosis and meiosis. The encoded protein is a plus end-directed microtubule motor and can interact with the SMC3 subunit of the cohesin complex. In addition, the encoded protein may be involved in the intracellular movement of membranous organelles. This protein and kinesin family member 3A form the kinesin II subfamily of the kinesin superfamily.

Characteristics: Antigen Size: 747 amino acids

Molecular Weight: 85kDa

Application Details

Application Notes: WB Suggested Anti-KIF3B Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Signaling, Cytoskeleton

Restrictions: For Research Use only

Images

WB Suggested Anti-KIF3B Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate

Publications

Weisschuh, Alavi, Bonin et al.: "Identification of genes that are linked with optineurin expression using a combined RNAi--microarray approach." in: Experimental eye research, Vol. 85, Issue 4, pp. 450-61, 2007 (PubMed).

Product: Jimbo, Kawasaki, Koyama et al.: "Identification of a link between the tumour suppressor APC and the kinesin superfamily." in: Nature cell biology, Vol. 4, Issue 4, pp. 323-7, 2002 (PubMed).