Vacuolar Protein Sorting 72 Homolog (S. Cerevisiae) (VPS72) antibody

Antigen: Vacuolar Protein Sorting 72 Homolog (S. Cerevisiae) (VPS72)

Synonyms: Tcfl1, vps72, MGC82727, si:dkeyp-24a7.1, Vps72, YL-1, ACYPI009531, YL1, CFL1, Swc2, TCFL1

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Rabbit, Zebrafish, Xenopus laevis

Application: Western Blotting (WB)

Catalog no.: ABIN182921

Additional Information

Alternative name: VPS72

Gene ID: TCFL1

UniProt: Q15906

Immunogen: The immunogen for anti-TCFL1 antibody: synthetic peptide directed towards the middle region of human TCFL1

Sequence: TEELNLRSLETYERLEADKKKQVHKKRKCPGPIITYHSVT VPLVGEPGPK

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rabbit, Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TCFL1 antibody concentration is 1 mg/ml.

Description: TCFL1 encodes the YL-1 protein which is a subunit of the TRRAP/TIP60 HAT complex, and also is a component of a novel mammalian multiprotein complex that includes the SNF2-related helicase SRCAP.

Characteristics: Antigen Size: 364 amino acids

Molecular Weight: 41kDa

Application Details

Application Notes: WB Suggested Anti-TCFL1 Antibody Titration: 0.06ug/ml
Positive Control: Human Lung.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-TCFL1 Antibody Titration: 0.06ug/ml
Positive Control: Human Lung

Publications

Product: Horikawa, Tanaka, Yuasa et al.: "Molecular cloning of a novel human cDNA on chromosome 1q21 and its mouse homolog encoding a nuclear protein with DNA-binding ability." in: Biochemical and biophysical research communications, Vol. 208, Issue 3, pp. 999-1007, 1995 (PubMed).