Kinesin Family Member 19 (KIF19) antibody

Antigen: Kinesin Family Member 19 (KIF19)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis, Zebrafish

Application: Western Blotting (WB)

Catalog no.: ABIN182923

Additional Information

Alternative name: KIF19

Gene ID: FLJ37300

UniProt: Q8N1X8

Immunogen: The immunogen for anti-FLJ37300 antibody: synthetic peptide directed towards the N terminal of human FLJ37300

Sequence: EVSMSYLEIYNEMIRDLLNPSLGYLELREDSKGVIQVAGI TEVSTINAKE

Cross-Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-FLJ37300 antibody concentration is 1 mg/ml.

Description: FLJ37300 is a hypothetical protein found on chromosome 17.

Characteristics: Antigen Size: 548 amino acids

Molecular Weight: 62kDa

Application Details

Application Notes: WB Suggested Anti-FLJ37300 Antibody Titration: 0.125ug/ml
Positive Control: Jurkat cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Signaling, Cytoskeleton

Restrictions: For Research Use only

Images

WB Suggested Anti-FLJ37300 Antibody Titration: 0.125ug/ml
Positive Control: Jurkat cell lysate

Publications

Product: Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).