Chromosome 14 Open Reading Frame 101 (C14orf101) (N-Term) antibody

Details for Product No. ABIN182981
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms C14orf101
Epitope
N-Term
(2)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(3), (1), (1), (1)
Host
Rabbit
(3)
Clonality
Polyclonal
Application
Western Blotting (WB)
(3)
Pubmed 1 reference available
Catalog no. ABIN182981
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human C14ORF101
Sequence WGDQTTLQGFLTHFLREEYGTFSLAKSEIGSSMSEILLSQ VTNMRTELSF
Predicted Reactivity Human : 100 %, Chicken : 90 %, Dog : 90 %, Guinea pig : 90 %, Horse : 90 %, Rabbit : 80 %
Characteristics This is a rabbit polyclonal antibody against C14ORF101. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C14ORF101
Background C14orf101 is a protein predicted based on an ORF found in chromosome 14.
Molecular Weight 79 kDa
Gene ID 54916
NCBI Accession NM_017799, NP_060269
UniProt Q9NX78
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 324 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chromosome 14 Open Reading Frame 101 (C14orf101) (N-Term) antibody WB Suggested Anti-C14ORF101 Antibody Titration: 0.125ug/ml
ELISA Titer: 1:12500
Positive Control: HepG2 cell lysate
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Hosts (3)
Reactivities (3), (1), (1), (1)
Applications (3)
Epitopes (2)
back to top