Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182981

Chromosome 14 Open Reading Frame 101 (C14orf101) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C14orf101
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182981
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C14ORF101 antibody: synthetic peptide directed towards the N terminal of human C14ORF101
Sequence WGDQTTLQGFLTHFLREEYGTFSLAKSEIGSSMSEILLSQ VTNMRTELSF
Predicted Reactivity Human : 100%, Chicken : 92%, Dog : 92%, Guinea pig : 92%, Horse : 92%, Rabbit : 85%
Characteristics This is a rabbit polyclonal antibody against C14ORF101. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C14ORF101
Background C14orf101 is a protein predicted based on an ORF found in chromosome 14.
Molecular Weight 79kDa
Gene ID 54916
NCBI Accession NP_060269, NM_017799
UniProt Q9NX78
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C14ORF101 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives for antigen "Chromosome 14 Open Reading Frame 101 (C14orf101)", type "Antibodies"
Hosts (3)
Reactivities (3), (1), (1), (1)
Applications (3)
Epitopes (2)
Beacon