MANSC Domain Containing 1 (MANSC1) antibody

Antigen: MANSC Domain Containing 1 (MANSC1)

Synonyms: FLJ10298, LOH12CR3, 9130403P13Rik, MANSC1, MGC143385, DKFZp469A172

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN182983

Additional Information

Alternative name: MANSC1

Gene ID: MANSC1

UniProt: Q9H8J5

Immunogen: The immunogen for anti-MANSC1 antibody: synthetic peptide directed towards the N terminal of human MANSC1

Sequence: LTLRLSASQNCLKKSLEDVVIDIQSSLSKGIRGNEPVYTS TQEDCINSCC

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-MANSC1 antibody concentration is 1 mg/ml.

Description: MANSC1, located on chromosome 12, encodes a protein whose function is not yet defined.

Characteristics: Antigen Size: 431 amino acids

Molecular Weight: 47kDa

Application Details

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

anti-MANSC Domain Containing 1 (MANSC1) antibody

anti-MANSC Domain Containing 1 (MANSC1) antibody (Image 2)

Publications

Clark, Edwards, Peterson et al.: "Fugu ESTs: new resources for transcription analysis and genome annotation." in: Genome research, Vol. 13, Issue 12, pp. 2747-53, 2003 (PubMed).

Product: Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).