Enolase 1, (Alpha) (ENO1) antibody
| Antigen | Enolase 1, (Alpha) (ENO1) |
| Synonyms | NNE, PPH, MPB1, MBP-1, ENO1L1, Eno-1, AL022784, MGC103111, MGC107267, 0610008I15, ENO1, MGC127526, zgc:73152, wu:fi32b03, wu:fk58e02, DKFZp459M1013, Eno1, enolase 1, F2P9.10, F2P9_10 |
| Clonality | Polyclonal |
| Host |
 Alternatives Rabbit |
| Reactivity |
Alternatives Chicken, Human, Mouse (Murine), Rat (Rattus), Pig (Porcine) |
| Conjugate |
Alternatives Un-conjugated |
| Application |
Alternatives Western Blotting (WB), Immunohistochemistry (IHC) |
 |
1 reference available |
| Catalog no. | ABIN182990 |
| Quantity | 50 µg (Variants) |
| Price | 317.90 $ Plus shipping costs $45.00 |
| Shipping to |
|
| Availability | Will be delivered in 2 to 3 Business Days |
Additional Information
| Alternative name | Alpha-enolase (ENO1) |
| Gene ID | ENO1 |
| UniProt | Q53HR3 |
| Immunogen | The immunogen for anti-ENO1 antibody: synthetic peptide directed towards the middle region of human ENO1 |
| Sequence | VAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLYKSFIK DYPVVSIEDP |
| Cross-Reactivity | Chicken, Human, Mouse (Murine), Pig (Porcine), Rat (Rattus) |
| Format | Lyophilized |
| Reconstitution | Add 50 µl of distilled water. Final anti-ENO1 antibody concentration is 1 mg/ml. |
| Description | ENO1 encodes one of three enolase isoenzymes found in mammals, it encodes alpha-enolase, a homodimeric soluble enzyme, and also encodes a shorter monomeric structural lens protein, tau-crystallin. The two proteins are made from the same message. The full length protein, the isoenzyme, is found in the cytoplasm. The shorter protein is produced from an alternative translation start, is localized to the nucleus, and has been found to bind to an element in the c-myc promoter. A pseudogene has been identified that is located on the other arm of the same chromosome. |
| Characteristics | Antigen Size: 434 amino acids |
| Molecular Weight | 47kDa |
Application Details
| Application Notes |
WB Suggested Anti-ENO1 Antibody Titration: 0.03ug/ml ELISA Titer: 1:1562500 Positive Control: Human Small Intestine. |
| Purification | Affinity Purified |
| Buffer | PBS |
| Storage (Long Term) | For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles. |
| Storage (Short Term) | Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. |
| Research Area | Enzymes, Metabolism |
| Restrictions | For Research Use only |
Images
|
WB Suggested Anti-ENO1 Antibody Titration: 0.03ug/ml ELISA Titer: 1:1562500 Positive Control: Human Small Intestine anti-Enolase 1, (Alpha) (ENO1) antibody (Image 2) |
Publications
| Product |
Lee, Chung, Kim et al.: "Human alpha-enolase from endothelial cells as a target antigen of anti-endothelial cell antibody in Behçet's disease." in: Arthritis and rheumatism, Vol. 48, Issue 7, pp. 2025-35, 2003 (PubMed).
|
Alternatives
Alternatives for antigen "Enolase 1, (Alpha) (ENO1)", type "Antibodies"
| Hosts | Rabbit (50), Mouse (14), Chicken (1) |
| Reactivities | Human (60), Mouse (Murine) (25), Rat (Rattus) (25), Cow (Bovine) (21), Chicken (3), Dog (Canine) (2), Arabidopsis (1), Caenorhabditis elegans (C. elegans) (1), Cat (Feline) (1), Xenopus laevis (1), Zebrafish (1) |
| Applications | Western Blotting (WB) (49), ELISA (41), Immunofluorescence (IF) (22), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (15), Immunohistochemistry (IHC) (7), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Fixed) (IHC (fx)) (2), Immunoprecipitation (IP) (2), Immunoelectron Microscopy (IEM) (1) |
| Conjugates | Biotin (2), FITC (2), HRP (2), Alexa Flour 488 (1), Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), Gold (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1) |
| Epitopes | N-Term (6), C-Term (4), Internal Region (2), Center (1) |
Sponsorship
2013 BioMed Central Research Awards
2013 BioMed Central Research Awards
