RRN3 RNA Polymerase I Transcription Factor Homolog (S. Cerevisiae) (RRN3) antibody

Antigen: RRN3 RNA Polymerase I Transcription Factor Homolog (S. Cerevisiae) (RRN3)

Synonyms: TIFIA, MGC104238, DKFZp566E104, RGD1305001, RRN3, DKFZp459B073, CG16938, CG3278, CG5951, DmelCG3278, dTIF-IA, Tif-1A, TIF-1A, TIF-IA, TifIA, dyak_GLEANR_13182, DyakGE12956, GE12956, Tif-IA

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken

Application: Western Blotting (WB)

Catalog no.: ABIN183012

Additional Information

Alternative name: RRN3

Gene ID: RRN3

UniProt: Q9NYV6

Immunogen: The immunogen for anti-RRN3 antibody: synthetic peptide directed towards the C terminal of human RRN3

Sequence: KKDIVEDEDDDFLKGEVPQNDTVIGITPSSFDTHFRSPSS SVGSPPVLYM

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-RRN3 antibody concentration is 1 mg/ml.

Description: RRN3 is RNA polymerase I-specific transcription initiation factor. Phosphorylation of RRN3 by MAPK cascades links cell signaling with the control of gene expression, namely results in rRNA synthesis in turn cell growth..

Characteristics: Antigen Size: 650 amino acids

Molecular Weight: 74kDa

Application Details

Application Notes: WB Suggested Anti-RRN3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-RRN3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate

Publications

Product: Miller, Panov, Friedrich et al.: "hRRN3 is essential in the SL1-mediated recruitment of RNA Polymerase I to rRNA gene promoters." in: The EMBO journal, Vol. 20, Issue 6, pp. 1373-82, 2001 (PubMed).