Zinc Finger, AN1-Type Domain 6 (ZFAND6) antibody

Antigen: Zinc Finger, AN1-Type Domain 6 (ZFAND6)

Synonyms: AWP1, ZA20D3, ZFAND5B, Awp1, Za20d3, 3110005P07Rik, MGC94805, zgc:101121, awp1, za20d2, za20d3, zfand5b, MGC75964, ZGC:101121, ZFAND6, MGC127770, DKFZp459F1624

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN183014

Additional Information

Alternative name: ZA20D3

Gene ID: ZA20D3

UniProt: Q6FIF0

Immunogen: The immunogen for anti-ZA20D3 antibody: synthetic peptide directed towards the middle region of human ZA20D3

Sequence: SDTAQQPSEEQSKSLEKPKQKKNRCFMCRKKVGLTGFECR CGNVYCGVHR

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-ZA20D3 antibody concentration is 1 mg/ml.

Description: ZA20D3 is a zinc-finger protein located on chromosome 15.

Characteristics: Antigen Size: 208 amino acids

Molecular Weight: 23kDa

Application Details

Application Notes: WB Suggested Anti-ZA20D3 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ZA20D3 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate

anti-Zinc Finger, AN1-Type Domain 6 (ZFAND6) antibody (Image 2)

Publications

Product: Duan, Sun, Li et al.: "Cloning and characterization of AWP1, a novel protein that associates with serine/threonine kinase PRK1 in vivo." in: Gene, Vol. 256, Issue 1-2, pp. 113-21, 2000 (PubMed).