Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Tripartite Motif Containing 41 (TRIM41) antibody

Antigen

Tripartite Motif Containing 41 (TRIM41)
Synonyms RINCK, MGC1127, MGC31991, R75223, AW552703, BC020156, MGC28280, MGC188087, TRIM41
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Cow (Bovine), Human, Dog (Canine), Mouse (Murine), Rat (Rattus)
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
1 reference available
Catalog no. ABIN183016
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Tripartite Motif Containing 41 (TRIM41) antibody

anti-Tripartite Motif Containing 41 (TRIM41) antibody (2)

Additional Information
Application Details Publications Images Alternatives Variants back to top

Alternative name TRIM41 / RINCK
Gene ID TRIM41
UniProt Q8WV44
Immunogen The immunogen for anti-TRIM41 antibody: synthetic peptide directed towards the C terminal of human TRIM41
Sequence AQSSTEQTLLSPSEKPRRFGVYLDYEAGRLGFYNAETLAH VHTFSAAFLG
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-TRIM41 antibody concentration is 1 mg/ml.
Description The TRIM41 gene encodes a protein observed in the cytoplasm and the nucleus. Nuclear transport is mediated by an N-terminal segment common to both alpha and beta isoforms, but independent of a classical nuclear localization signal sequence.
Characteristics Antigen Size: 630 amino acids
Molecular Weight 72kDa

Application Details
Publications Images Alternatives Variants back to top

Application Notes WB Suggested Anti-TRIM41 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Liver.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications
Application Details Images Alternatives Variants back to top

Product Kobayashi, Hanai: "M phase-specific association of human topoisomerase IIIbeta with chromosomes." in: Biochemical and biophysical research communications, Vol. 287, Issue 1, pp. 282-7, 2001 (PubMed).

Alternatives
Application Details Publications Images Variants back to top

Alternatives for antigen "Tripartite Motif Containing 41 (TRIM41)", type "Antibodies"
Hosts Rabbit (27)
Reactivities Human (27), Mouse (Murine) (22), Rat (Rattus) (22), Cow (Bovine) (2), Dog (Canine) (2), Chicken (1), Xenopus laevis (1), Zebrafish (1)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (12), ELISA (6), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes N-Term (2), C-Term (1)