Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Suppressor of Variegation 4-20 Homolog 1 (Drosophila) (SUV420H1) antibody

Antigen

Suppressor of Variegation 4-20 Homolog 1 (Drosophila) (SUV420H1)
Synonyms CGI85, KMT5B, CGI-85, MGC703, MGC21161, MGC118906, MGC118909, AA117471, MGC18702, Suv4-20h1, C630029K18Rik, SUV420H1, wu:fb97g06, wu:fi57g03, zgc:103527, MGC137299
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Chicken, Human, Mouse (Murine), Rat (Rattus), Xenopus laevis
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN183037
Quantity 100 µg  (Variants)
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Suppressor of Variegation 4-20 Homolog 1 (Drosophila) (SUV420H1) antibody

Additional Information
Application Details Publications Images Alternatives Variants back to top

Alternative name SUV420H1 / KMT5B
Gene ID SUV420H1
UniProt Q4V775
Immunogen The immunogen for anti-SUV420H1 antibody: synthetic peptide directed towards the C terminal of human SUV420H1
Sequence NNGFNSGSGSSSTKLKIQLKRDEENRGSYTEGLHENGVCC SDPLSLLESR
Cross-Reactivity Chicken, Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-SUV420H1 antibody concentration is 1 mg/ml.
Description SUV420H1 is a protein that contains a SET domain. SET domains appear to be protein-protein interaction domains that mediate interactions with a family of proteins that display similarity with dual-specificity phosphatases (dsPTPases). The function of this gene has not been determined.
Characteristics Antigen Size: 471 amino acids
Molecular Weight 52kDa

Application Details
Publications Images Alternatives Variants back to top

Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications
Application Details Images Alternatives Variants back to top

Product Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Alternatives
Application Details Publications Images Variants back to top

Alternatives for antigen "Suppressor of Variegation 4-20 Homolog 1 (Drosophila) (SUV420H1)", type "Antibodies"
Hosts Rabbit (13)
Reactivities Human (12), Mouse (Murine) (3), Chicken (1), Cow (Bovine) (1), Dog (Canine) (1), Rat (Rattus) (1), Xenopus laevis (1)
Applications Western Blotting (WB) (13), ELISA (6), Immunohistochemistry (IHC) (3), Chromatin Immunoprecipitation (ChiP) (1), Immunohistochemistry (Frozen Sections) (IHC (fro)) (1), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (1)
Epitopes C-Term (4), Internal Region (3), Isoform 3 (1), N-Term (1)