Kelch-Like 28 (Drosophila) (KLHL28) antibody

Antigen: Kelch-Like 28 (Drosophila) (KLHL28)

Synonyms: BTBD5, FLJ20081, MGC166193

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken, Xenopus laevis

Application: Western Blotting (WB)

Catalog no.: ABIN183038

Additional Information

Alternative name: BTBD5 / KLHL28

Gene ID: BTBD5

UniProt: Q9NXS3

Immunogen: The immunogen for anti-BTBD5 antibody: synthetic peptide directed towards the middle region of human BTBD5

Sequence: GVVVLAGELYALGGYDGQSYLQSVEKYIPKIRKWQPVAPM TTTRSCFAAA

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-BTBD5 antibody concentration is 1 mg/ml.

Description: BTBD5 is a transcription factor containing BTB (POZ) domain

Characteristics: Antigen Size: 571 amino acids

Molecular Weight: 64kDa

Application Details

Application Notes: WB Suggested Anti-BTBD5 Antibody Titration: 1.0ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-BTBD5 Antibody Titration: 1.0ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate

Publications

Product: Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).