Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Kelch-Like 36 (Drosophila) (KLHL36) antibody

Antigen

Kelch-Like 36 (Drosophila) (KLHL36)

Synonyms C16orf44, FLJ12543, MGC37805, MGC110268, zgc:110268, CH73-77K24.1
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN183049
Quantity 0.1 mg  (Variants)
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name KLHL36
Gene ID C16ORF44
UniProt Q8N4N3
Immunogen The immunogen for anti-C16ORF44 antibody: synthetic peptide directed towards the N terminal of human C16ORF44
Sequence FCCEYLEQEVSEDNYLYLQELASIYSLKRLDAFIDGFILN HFGTLSFTPD
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-C16ORF44 antibody concentration is 1 mg/ml.
Description C16orf44 is an open reading frame 44, found in chromosome 16
Characteristics Antigen Size: 616 amino acids
Molecular Weight 70kDa

Application Details

Application Notes WB Suggested Anti-C16ORF44 Antibody Titration: 1.0ug/ml
ELISA Titer: 1:500
Positive Control: HepG2 cell lysate.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives

Alternatives for antigen "Kelch-Like 36 (Drosophila) (KLHL36)", type "Antibodies"
Hosts Rabbit (25)
Reactivities Human (25), Cow (Bovine) (19), Mouse (Murine) (19), Rat (Rattus) (19), Dog (Canine) (18), Horse (Equine) (18), Sheep (Ovine) (18)
Applications Immunofluorescence (IF) (15), ELISA (8), Western Blotting (WB) (6), Immunohistochemistry (IHC) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1)
Epitopes C-Term (3), Internal Region (1), N-Term (1)