LAS1-Like (S. Cerevisiae) (LAS1L) antibody

Antigen: LAS1-Like (S. Cerevisiae) (LAS1L)

Synonyms: FLJ12525, dJ475B7.2, RP3-475B7.2

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human

Application: Western Blotting (WB)

Catalog no.: ABIN183053

Additional Information

Alternative name: LAS1L

Gene ID: LAS1L

UniProt: Q9Y4W2

Immunogen: The immunogen for anti-LAS1L antibody: synthetic peptide directed towards the C terminal of human LAS1L

Sequence: SSFGSEAKAQQQEEQGSVNDVKEEEKEEKEVLPDQVEEEE ENDDQEEEEE

Cross-Reactivity: Cow (Bovine), Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-LAS1L antibody concentration is 1 mg/ml.

Description: The function of LAS1L has not been determined.

Characteristics: Antigen Size: 734 amino acids

Molecular Weight: 83kDa

Application Details

Application Notes: WB Suggested Anti-LAS1L Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-LAS1L Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate

Publications

Product: Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).