Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Kelch-Like 13 (Drosophila) (KLHL13) antibody

Antigen

Kelch-Like 13 (Drosophila) (KLHL13)
Synonyms BKLHD2, FLJ10262, KIAA1309, MGC74791, KLHL13
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Cow (Bovine), Human, Dog (Canine), Mouse (Murine)
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
1 reference available
Catalog no. ABIN183060
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Kelch-Like 13 (Drosophila) (KLHL13) antibody

anti-Kelch-Like 13 (Drosophila) (KLHL13) antibody (2)

Additional Information
Application Details Publications Images Alternatives back to top

Alternative name Kelch-like protein 13
Gene ID KLHL13
Immunogen The immunogen for anti-KLHL13 antibody: synthetic peptide directed towards the N terminal of human KLHL13
Sequence KTSSPAIWKFPVPVLKTSRSTPLSPAYISLVEEEDQHMKL SLGGSEMGLS
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-KLHL13 antibody concentration is 1 mg/ml.
Description KLHL13 contains 6 Kelch repeats and 1 BTB (POZ) domain. The function of this protein remains unknown
Characteristics Antigen Size: 655 amino acids
Molecular Weight 74kDa

Application Details
Publications Images Alternatives back to top

Application Notes WB Suggested Anti-KLHL13 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications
Application Details Images Alternatives back to top

Product Nagase, Kikuno, Ishikawa et al.: "Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro." in: DNA research : an international journal for rapid publication of reports on genes and genomes, Vol. 7, Issue 1, pp. 65-73, 2000 (PubMed).

Alternatives
Application Details Publications Images back to top

Alternatives for antigen "Kelch-Like 13 (Drosophila) (KLHL13)", type "Antibodies"
Hosts Rabbit (25), Mouse (2)
Reactivities Human (27), Mouse (Murine) (21), Rat (Rattus) (21), Cow (Bovine) (18), Zebrafish (Danio rerio) (17), Cat (Feline) (1), Chicken (1), Dog (Canine) (1)
Applications Immunofluorescence (IF) (17), Western Blotting (WB) (12), ELISA (10), Immunohistochemistry (IHC) (5), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Flow Cytometry (FACS) (2), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Immunoelectron Microscopy (IEM) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes N-Term (2)