Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183090

Bromodomain Containing 9 (BRD9) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms LAVS3040, PRO9856, AL022779, zgc:55797, BRD9
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN183090
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-BRD9 antibody: synthetic peptide directed towards the N terminal of human BRD9
Sequence VTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMM SKQAALLGNE
Predicted Reactivity Bovine : 100%, Chicken : 100%, Dog : 100%, Guinea pig : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Horse : 92%, African clawed frog : 84%, Zebrafish : 76%
Characteristics This is a rabbit polyclonal antibody against BRD9. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name BRD9
Background BRD9 is a member of protein family that contains bromodomain. It is potentially related to cancer.
Molecular Weight 53kDa
Gene ID 65980
NCBI Accession NP_001009877, NM_001009877
UniProt Q9H8M2
Research Area Chromatin and Nuclear Signaling, Transcription Factors, Chromatin Binding Proteins
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-BRD9 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

Clark, Edwards, Peterson et al.: "Fugu ESTs: new resources for transcription analysis and genome annotation." in: Genome research, Vol. 13, Issue 12, pp. 2747-53, 2003 (PubMed).

Alternatives for antigen "Bromodomain Containing 9 (BRD9)", type "Antibodies"
Hosts (7)
Reactivities (7), (5), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Applications (7), (1)
Epitopes (7), (2), (1)
Beacon