Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Chromosome 22 Open Reading Frame 31 (C22orf31) antibody

Antigen

Chromosome 22 Open Reading Frame 31 (C22orf31)
Synonyms HS747E2A, bK747E2.1
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Cow (Bovine), Human
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN183091
Quantity 0.1 mg  (Variants)
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Chromosome 22 Open Reading Frame 31 (C22orf31) antibody

Additional Information
Application Details Publications Images Alternatives Variants back to top

Alternative name C22orf31
Gene ID HS747E2A
Immunogen The immunogen for anti-HS747E2A antibody: synthetic peptide directed towards the middle region of human HS747E2A
Sequence MKATQQARKRNFISSKSKQPAGHRRPAGGIRESKESSKEK KLTVRQDLED
Cross-Reactivity Cow (Bovine), Human
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-HS747E2A antibody concentration is 1 mg/ml.
Description The gene encoding the hypothetical protein HS747E2A is located on chromosome 22.
Characteristics Antigen Size: 290 amino acids
Molecular Weight 33kDa

Application Details
Publications Images Alternatives Variants back to top

Application Notes WB Suggested Anti-HS747E2A Antibody Titration: 1.25ug/ml
ELISA Titer: 1:500
Positive Control: HepG2 cell lysate.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications
Application Details Images Alternatives Variants back to top

Product Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).

Alternatives
Application Details Publications Images Variants back to top

Alternatives for antigen "Chromosome 22 Open Reading Frame 31 (C22orf31)", type "Antibodies"
Hosts Rabbit (25)
Reactivities Human (25), Cow (Bovine) (18), Mouse (Murine) (18), Rat (Rattus) (18)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (10), ELISA (5), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes Internal Region (2), N-Term (1)