Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Zinc Finger Protein 568 (ZNF568) antibody

Antigen

Zinc Finger Protein 568 (ZNF568)
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Cow (Bovine), Human
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN183105
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Zinc Finger Protein 568 (ZNF568) antibody

Additional Information
Application Details Publications Images Alternatives Variants back to top

Alternative name ZNF568
Gene ID ZNF568
UniProt Q6N060
Immunogen The immunogen for anti-ZNF568 antibody: synthetic peptide directed towards the N terminal of human ZNF568
Sequence SKKILIKEKVIECKKVAKIFPLSSDIVTSRQSFYDCDSLD KGLEHNLDLL
Cross-Reactivity Cow (Bovine), Human
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-ZNF568 antibody concentration is 1 mg/ml.
Description The function of the Anti-ZNF568 gene has not yet been determined
Characteristics Antigen Size: 377 amino acids
Molecular Weight 44kDa

Application Details
Publications Images Alternatives Variants back to top

Application Notes WB Suggested Anti-ZNF568 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human brain.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only

Publications
Application Details Images Alternatives Variants back to top

Product Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives
Application Details Publications Images Variants back to top

Alternatives for antigen "Zinc Finger Protein 568 (ZNF568)", type "Antibodies"
Hosts Rabbit (23)
Reactivities Human (23), Cow (Bovine) (2), Dog (Canine) (1), Mouse (Murine) (1), Rat (Rattus) (1)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (8), ELISA (3), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes N-Term (3)