Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Zinc Finger Protein 57 (ZFP57) antibody

Antigen

Zinc Finger Protein 57 (ZFP57)
Synonyms ZNF424
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Human
Application
Alternatives Western Blotting (WB)
2 references available
Catalog no. ABIN183107
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Zinc Finger Protein 57 (ZFP57) antibody

Additional Information
Application Details Publications Images Alternatives Variants back to top

Alternative name ZNF57
Gene ID ZNF57
UniProt Q68EA5
Immunogen The immunogen for anti-ZNF57 antibody: synthetic peptide directed towards the N terminal of human ZNF57
Sequence FTLEEWALLDSAQRDLYRDVMLETFRNLASVDDGTQFKAN GSVSLQDMYG
Cross-Reactivity Human
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-ZNF57 antibody concentration is 1 mg/ml.
Description ZNF57 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 13 C2H2-type zinc fingers and 1 KRAB domain. ZNF57 may be involved in transcriptional regulation.
Characteristics Antigen Size: 555 amino acids
Molecular Weight 64kDa

Application Details
Publications Images Alternatives Variants back to top

Application Notes WB Suggested Anti-ZNF57 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: HepG2 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only

Publications
Application Details Images Alternatives Variants back to top

Lichter, Bray, Ried et al.: "Clustering of C2-H2 zinc finger motif sequences within telomeric and fragile site regions of human chromosomes." in: Genomics, Vol. 13, Issue 4, pp. 999-1007, 1992 (PubMed).

Product Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Alternatives
Application Details Publications Images Variants back to top

Alternatives for antigen "Zinc Finger Protein 57 (ZFP57)", type "Antibodies"
Hosts Rabbit (5)
Reactivities Human (5), Mouse (Murine) (2), Chicken (1), Cow (Bovine) (1), Dog (Canine) (1), Rat (Rattus) (1)
Applications Western Blotting (WB) (5), ELISA (1)
Epitopes N-Term (2), C-Term (1)