Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183124

Chloride Intracellular Channel 1 (CLIC1) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms G6, NCC27, Clcp, zgc:77044, wu:fc30e04, ncc27, xclic1, MGC75951, MGC132377, CLIC1
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Rabbit, Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183124
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CLIC1 antibody: synthetic peptide directed towards the C terminal of human CLIC1
Sequence LTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSN AYAREEFAST
Predicted Reactivity Human : 100%, Mouse : 100%, Rat : 100%, Rabbit : 92%, Bovine : 83%, Goat : 83%
Characteristics This is a rabbit polyclonal antibody against CLIon Channel1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name CLIC1
Background Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 1 (CLIon Channel1) is a member of the p64 family, the protein localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity.
Molecular Weight 27kDa
Gene ID 1192
NCBI Accession NP_001279, NM_001288
UniProt Q502X1
Research Area Signaling, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CLIC1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Novarino, Fabrizi, Tonini et al.: "Involvement of the intracellular ion channel CLIC1 in microglia-mediated beta-amyloid-induced neurotoxicity." in: The Journal of neuroscience : the official journal of the Society for Neuroscience, Vol. 24, Issue 23, pp. 5322-30, 2004 (PubMed).

Alternatives for antigen "Chloride Intracellular Channel 1 (CLIC1)", type "Antibodies"
Hosts (35), (21)
Reactivities (52), (16), (16), (13), (13), (1), (1), (1), (1)
Applications (45), (30), (16), (14), (10), (6), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (8), (8), (4), (3), (2), (1)
Beacon