Did you know that you can buy products from over 140 different suppliers from us?

Chloride Intracellular Channel 1 (CLIC1) (C-Term) antibody

Details for Product No. ABIN183124
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ncc27, xclic1, MGC75951, MGC132377, CLIC1, G6, NCC27, Clcp, wu:fc30e04, zgc:77044
Epitope
C-Term
(8), (8), (4), (4), (3), (2), (2), (2), (1), (1), (1), (1)
Reactivity
Rabbit, Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(61), (16), (16), (13), (13), (1), (1), (1), (1)
Host
Rabbit
(38), (23), (4)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(54), (35), (17), (15), (10), (9), (6), (2), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183124
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human CLIC1
Sequence LTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSN AYAREEFAST
Predicted Reactivity Human : 100 %, Mouse : 100 %, Rat : 100 %, Rabbit : 90 %, Bovine : 80 %, Goat : 80 %
Characteristics This is a rabbit polyclonal antibody against CLIon Channel1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name CLIC1
Background Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 1 (CLIon Channel1) is a member of the p64 family, the protein localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity.
Molecular Weight 27 kDa
Gene ID 1192
NCBI Accession NM_001288, NP_001279
UniProt Q502X1
Research Area Signaling, Metabolism
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 241 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chloride Intracellular Channel 1 (CLIC1) (C-Term) antibody WB Suggested Anti-CLIC1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
Background publications Novarino, Fabrizi, Tonini et al.: "Involvement of the intracellular ion channel CLIC1 in microglia-mediated beta-amyloid-induced neurotoxicity." in: The Journal of neuroscience : the official journal of the Society for Neuroscience, Vol. 24, Issue 23, pp. 5322-30, 2004 (PubMed).

Validation Images
back to top