Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

VDAC antibody

Antigen

VDAC
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Rabbit, Pig (Porcine), Chicken, Xenopus laevis, Zebrafish
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
1 reference available
Catalog no. ABIN183134
Quantity 0.1 mg
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-VDAC antibody

anti-VDAC antibody (2)

Additional Information
Application Details Publications Images Alternatives back to top

Gene ID VDAC1
UniProt Q5FVE7
Immunogen The immunogen for anti-VDAC1 antibody: synthetic peptide directed towards the C terminal of human VDAC1
Sequence SAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGH KLGLGLEFQA
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Pig (Porcine), Rabbit, Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-VDAC1 antibody concentration is 1 mg/ml.
Description The voltage-dependent anion-selective channel 1 (VDAC1) functions as a channel in membranous structures for the outer mitochondrial membrane, the cell membrane, endosomes, caveolae, the sarcoplasmatic reticulum, synaptosomes, and post-synaptic density fraction. A major function of VDAC1 in the plasma membrane is that of a NADH(-ferricyanide) reductase that may be involved in the maintenance of cellular redox homeostasis.
Characteristics Antigen Size: 283 amino acids
Molecular Weight 31kDa

Application Details
Publications Images Alternatives back to top

Application Notes WB Suggested Anti-VDAC1 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications
Application Details Images Alternatives back to top

Product Zheng, Shi, Tian et al.: "Essential role of the voltage-dependent anion channel (VDAC) in mitochondrial permeability transition pore opening and cytochrome c release induced by arsenic trioxide." in: Oncogene, Vol. 23, Issue 6, pp. 1239-47, 2004 (PubMed).

Alternatives
Application Details Publications Images back to top

Alternatives for antigen "VDAC", type "Antibodies"
Hosts Rabbit (18)
Reactivities Cow (Bovine) (18), Dog (Canine) (18), Horse (Equine) (18), Human (18), Mouse (Murine) (18), Pig (Porcine) (18), Rat (Rattus) (18), Sheep (Ovine) (18)
Applications Immunofluorescence (IF) (15), ELISA (3), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Western Blotting (WB) (3), Immunoelectron Microscopy (IEM) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)