Cation Channel, Sperm Associated 2 (CATSPER2) (C-Term) antibody

Details for Product No. ABIN183175
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms CATSPER2
Epitope
C-Term
(4), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
(20), (14), (13), (13), (13), (12)
Host
Rabbit
(22), (1), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(14), (10), (4), (3), (3), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN183175
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human CATSPER2
Sequence LMEMDQDDRVWPRDSLFRYFELLEKLQYNLEERKKLQEFA VQALMNLEDK
Predicted Reactivity Human : 100 %, Bovine : 90 %, Dog : 90 %, Guinea pig : 90 %, Horse : 90 %, Pig : 90 %, Rabbit : 90 %
Characteristics This is a rabbit polyclonal antibody against CATSPER2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name CATSPER2
Background Calcium ions play a primary role in the regulation of sperm motility. This gene belongs to a family of putative cation channels that are specific to spermatozoa and localize to the flagellum. The protein family features a single repeat with six membrane-spanning segments and a predicted calcium-selective pore region. This gene is part of a tandem repeat on chromosome 15q14, the second copy of this gene is thought to be a pseudogene. Additional splice variants have been described but their full-length nature has not been determined.
Molecular Weight 58 kDa
Gene ID 117155
NCBI Accession NM_054020, NP_473361
UniProt Q96P56
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 528 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Cation Channel, Sperm Associated 2 (CATSPER2) (C-Term) antibody WB Suggested Anti-CATSPER2 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
Background publications Quill, Ren, Clapham et al.: "A voltage-gated ion channel expressed specifically in spermatozoa." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 98, Issue 22, pp. 12527-31, 2001 (PubMed).

Hosts (22), (1), (1)
Reactivities (20), (14), (13), (13), (13), (12)
Applications (14), (10), (4), (3), (3), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (2), (1), (1)
back to top