Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183175

Cation Channel, Sperm Associated 2 (CATSPER2) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CATSPER2
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183175
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CATSPER2 antibody: synthetic peptide directed towards the C terminal of human CATSPER2
Sequence LMEMDQDDRVWPRDSLFRYFELLEKLQYNLEERKKLQEFA VQALMNLEDK
Predicted Reactivity Human : 100%, Bovine : 92%, Dog : 92%, Guinea pig : 92%, Horse : 92%, Pig : 92%, Rabbit : 92%
Characteristics This is a rabbit polyclonal antibody against CATSPER2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name CATSPER2
Background Calcium ions play a primary role in the regulation of sperm motility. This gene belongs to a family of putative cation channels that are specific to spermatozoa and localize to the flagellum. The protein family features a single repeat with six membrane-spanning segments and a predicted calcium-selective pore region. This gene is part of a tandem repeat on chromosome 15q14, the second copy of this gene is thought to be a pseudogene. Additional splice variants have been described but their full-length nature has not been determined.
Molecular Weight 58kDa
Gene ID 117155
NCBI Accession NP_473361, NM_054020
UniProt Q96P56
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CATSPER2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Quill, Ren, Clapham et al.: "A voltage-gated ion channel expressed specifically in spermatozoa." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 98, Issue 22, pp. 12527-31, 2001 (PubMed).

Alternatives for antigen "Cation Channel, Sperm Associated 2 (CATSPER2)", type "Antibodies"
Hosts (24)
Reactivities (21), (13), (13), (12), (12), (12)
Applications (15), (10), (4), (3), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (4), (3)
Beacon