Cation Channel, Sperm Associated 2 (CATSPER2) antibody

Antigen: Cation Channel, Sperm Associated 2 (CATSPER2)

Synonyms: MGC33346, CATSPER2

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN183175

Additional Information

Alternative name: CATSPER2

Gene ID: CATSPER2

UniProt: Q96P56

Immunogen: The immunogen for anti-CATSPER2 antibody: synthetic peptide directed towards the C terminal of human CATSPER2

Sequence: LMEMDQDDRVWPRDSLFRYFELLEKLQYNLEERKKLQEFA VQALMNLEDK

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-CATSPER2 antibody concentration is 1 mg/ml.

Description: Calcium ions play a primary role in the regulation of sperm motility. This gene belongs to a family of putative cation channels that are specific to spermatozoa and localize to the flagellum. The protein family features a single repeat with six membrane-spanning segments and a predicted calcium-selective pore region. This gene is part of a tandem repeat on chromosome 15q14, the second copy of this gene is thought to be a pseudogene. Additional splice variants have been described but their full-length nature has not been determined.

Characteristics: Antigen Size: 528 amino acids

Molecular Weight: 58kDa

Application Details

Application Notes: WB Suggested Anti-CATSPER2 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-CATSPER2 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate

Publications

Product: Quill, Ren, Clapham et al.: "A voltage-gated ion channel expressed specifically in spermatozoa." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 98, Issue 22, pp. 12527-31, 2001 (PubMed).